Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAITANSTLLQE
None.
Species containing the peptide CGSQAGGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Arabis alpina | Gray rockcress | KFK37886 |
50452 |
Brachypodium distachyon | Brachypodium distachyon | XP_010237391 |
15368 |
Cajanus cajan | Pigeon pea | KYP71795 |
3821 |
Camellia sinensis | Camellia sinensis | AKM77643 |
4442 |
Elaeis guineensis | African oil palm | XP_010941404 XP_010941401 |
51953 |
Eucalyptus grandis | Eucalyptus grandis | KCW55631 XP_010028812 |
71139 |
Hordeum vulgare | Hordeum vulgare | P15312 |
4513 |
Hordeum vulgare subsp. vulgare | Domesticated barley | P15312 |
112509 |
Setaria italica | Foxtail millet | KQL15589 |
4555 |
Triticum aestivum | Bread wheat | 1WGC_A 2X52_A 2X52_A P10969 P10969 1WGT_A 1WGT_A P10968 |
4565 |
Triticum durum | Durum wheat | P10969 P10969 |
4567 |
Triticum urartu | Triticum urartu | EMS64751 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.