Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLHAAQ
None.
Species containing the peptide FPAAVFLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Triticum aestivum | Bread wheat | CAB96931 O64394 AAL24517 |
4565 |
Triticum durum | Durum wheat | AAL24517 |
4567 |
Triticum urartu | Triticum urartu | EMS65494 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.