Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLHAAQ
None.
Species containing the peptide LVVIDFTASWCGPCR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Sonneratia ovata | Sonneratia ovata | ABQ42150 |
122816 |
Glycine max | Soybean | XP_003534466 |
3847 |
Glycine soja | Glycine soja | XP_003534466 |
3848 |
Hordeum vulgare subsp. vulgare | Domesticated barley | 2VLT_A BAJ99002 |
112509 |
Musa acuminata subsp. malaccensis | Wild malaysian banana | XP_009398388 |
214687 |
Nannochloropsis gaditana | Nannochloropsis gaditana | EWM28076 |
72520 |
Olea europaea | Common olive | AFP49340 |
4146 |
Oryza sativa Indica Group | Long-grained rice | XP_015640796 |
39946 |
Oryza sativa Japonica Group | Japanese rice | BAB20886 XP_015640796 |
39947 |
Plantago major | Common plantain | CAH59450 |
29818 |
Setaria italica | Foxtail millet | XP_004955694 |
4555 |
Sonneratia apetala | Sonneratia apetala | ABQ42151 |
122813 |
Sonneratia caseolaris | Sonneratia caseolaris | ABQ42149 |
122814 |
Sorghum bicolor | Sorghum | XP_002461568 KXG34557 |
4558 |
Triticum aestivum | Bread wheat | CAB96931 O64394 AAL24517 |
4565 |
Triticum durum | Durum wheat | AAL24517 |
4567 |
Triticum urartu | Triticum urartu | EMS65494 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.