If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: IEMPGPPYLAK

Peptide within the protein Tri-a-40:

MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQWS

References reporting this peptide:


Species Uniqueness

Species containing the peptide IEMPGPPYLAK are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name Common name Accession(s) Tax ID
Aegilops tauschii Aegilops tauschii EMT10686
37682
Triticum aestivum Bread wheat CAA42453
4565

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.