Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQWS
Species containing the peptide SRPDQSGLMELPGCPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Aegilops tauschii | Aegilops tauschii | EMT10686 |
37682 |
Hordeum vulgare | Hordeum vulgare | P32936 |
4513 |
Hordeum vulgare subsp. vulgare | Domesticated barley | P32936 |
112509 |
Secale cereale | Rye | AAZ67071 |
4550 |
Triticum aestivum | Bread wheat | ACG59281 P16159 CAA42453 |
4565 |
Triticum durum | Durum wheat | P16159 |
4567 |
Triticum macha | Triticum macha | ACM41416 |
69994 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.