Peptide within the protein Tri-a-42:

References reporting this peptide:

None.

Species Uniqueness

Species containing the peptide SIEPSFPVSFQYGNSFPYPMTVASASCDCN are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name	Common name	Accession(s)	Tax ID
Triticum aestivum	Bread wheat	AKJ77986	4565
Triticum urartu	Triticum urartu	EMS64008	4572

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.

---