Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAKLMCLCFIILTIAVVVSADECEGDRQEMIKQCAKYQQWPANPKVNPSDACCAVWQKANIPCLCAGVTKEKEKIWCMEKVAYVANFCKKPFPHGYKCGSYTFPPLA
None.
Species containing the peptide KPFPHGYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Aegilops tauschii | Aegilops tauschii | EMT24886 EMT09161 EMT05305 EMT19106 |
37682 |
Hordeum vulgare subsp. vulgare | Domesticated barley | BAK07942 BAK05749 BAK05648 |
112509 |
Triticum aestivum | Bread wheat | CAI64398 AKJ77990 ACA04813 |
4565 |
Triticum durum | Durum wheat | ACN54189 |
4567 |
Triticum urartu | Triticum urartu | EMS46765 EMS63283 EMS60276 EMS35731 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.