Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM
None.
Species containing the peptide DFGDVNSFVNVDPEGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Fenneropenaeus merguiensis | Fenneropenaeus merguiensis | ACP43442 |
71412 |
Litopenaeus vannamei | Pacific white shrimp | ADN43035 4BHL_A 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 |
6689 |
Metapenaeus ensis | Metapenaeus ensis | ACA51932 |
32278 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.