Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM
None.
Food | Protein | Taxid |
---|---|---|
Shrimp | Lit-v-2.0101 | 6689 |
Shrimp | Pen-m-2.0101 | 6687 |
Species containing the peptide EMQDGILELIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
Species name | Common name | Accession(s) | Tax ID |
---|---|---|---|
Aleuroglyphus ovatus | Brown legged grain mite | ABU97463 ABU97463 |
212130 |
Callinectes sapidus | Blue crab | Q9NH49 Q9NH49 |
6763 |
Carcinus maenas | Green crab | Q9U9J4 Q9U9J4 |
6759 |
Cherax cainii | Cherax cainii | AJO70187 AJO70187 |
223846 |
Cherax destructor | Cherax destructor | AJO70004 AJO70004 |
6723 |
Cherax quadricarinatus | Cherax quadricarinatus | AIW68608 AKG50107 AIW68608 AKG50107 |
27406 |
Chionoecetes opilio | Snow crab | P86699 P86699 |
41210 |
Dermatophagoides farinae | American house dust mite | AIO08850 AAP57094 AIO08850 AAP57094 |
6954 |
Dermatophagoides pteronyssinus | European house dust mite | ACD50950 ACD50950 |
6956 |
Eriocheir sinensis | Chinese mitten crab | Q9NH48 Q9NH48 |
95602 |
Fenneropenaeus chinensis | Fenneropenaeus chinensis | AAS98886 AAV83993 AAS98886 AAV83993 |
139456 |
Fenneropenaeus merguiensis | Fenneropenaeus merguiensis | ACP43442 ACP43442 |
71412 |
Glycyphagus domesticus | Glycyphagus domesticus | ABU97463 ABU97463 |
105145 |
Halocaridina rubra | Hawaiian volcano shrimp | AIM43582 AIM43581 AIM43582 AIM43581 |
373956 |
Homarus gammarus | European lobster | P14208 P14208 |
6707 |
Hyalella azteca | Hyalella azteca | XP_018020845 XP_018020845 |
294128 |
Limulus polyphemus | Atlantic horseshoe crab | XP_013790978 XP_013790978 |
6850 |
Litopenaeus vannamei | Pacific white shrimp | 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 |
6689 |
Macrophthalmus japonicus | Macrophthalmus japonicus | AID47194 AID47194 |
138195 |
Metapenaeus ensis | Metapenaeus ensis | ACA51932 ACA51932 |
32278 |
Metaseiulus occidentalis | Western predatory mite | XP_003742610 XP_003742610 |
34638 |
Neocaridina denticulata | Japanese swamp shrimp | BAH56609 BAH56609 |
274642 |
Neohelice granulata | Neohelice granulata | AAF43438 AAF43438 |
53323 |
Orchesella cincta | Orchesella cincta | ODM94001 ODM94001 |
48709 |
Pachygrapsus marmoratus | Marbled crab | Q9GYX1 Q9GYX1 |
135190 |
Parasteatoda tepidariorum | Common house spider | XP_015923977 XP_015923976 XP_015923975 XP_015923977 XP_015923976 XP_015923975 |
114398 |
Penaeus monodon | Black tiger shrimp | AAO15713 AGV55412 C7E3T4 AAO15713 AGV55412 C7E3T4 |
6687 |
Procambarus clarkii | Red swamp crayfish | ABZ79135 AFA45339 ABZ79135 AFA45339 |
6728 |
Rhagoletis zephyria | Snowberry fruit fly | XP_017461640 XP_017461640 |
28612 |
Sarcoptes scabiei | Sarcoptes scabiei | KPM02376 KPM07362 KPM02376 KPM07362 |
52283 |
Scylla olivacea | Orange mud crab | ACP43443 ACP43443 |
85551 |
Scylla paramamosain | Green mud crab | AFK25805 AFA45340 AEY84969 AFK25805 AFA45340 AEY84969 |
85552 |
Scylla serrata | Giant mud crab | ACV96855 ACV96855 |
6761 |
Stegodyphus mimosarum | Stegodyphus mimosarum | KFM68830 KFM68830 |
407821 |
Trypanosoma brucei | Trypanosoma brucei | AAF23164 AAF23164 |
5691 |
Trypanosoma brucei TREU927 | Trypanosoma brucei treu927 | XP_827001 XP_826999 XP_826998 XP_827001 XP_826999 XP_826998 |
185431 |
Trypanosoma brucei gambiense DAL972 | Trypanosoma brucei gambiense dal972 | XP_011776525 XP_011776523 XP_011776521 XP_011776520 XP_011776525 XP_011776523 XP_011776521 XP_011776520 |
679716 |
Trypanosoma cruzi | Trypanosoma cruzi | O96507 XP_806409 EKG01912 2J1Q_A O96507 XP_806409 EKG01912 2J1Q_A |
5693 |
Trypanosoma cruzi Dm28c | Trypanosoma cruzi dm28c | ESS68123 ESS68123 |
1416333 |
Trypanosoma cruzi marinkellei | Trypanosoma cruzi marinkellei | EKF30369 EKF30369 |
85056 |
Trypanosoma cruzi strain CL Brener | Trypanosoma cruzi strain cl brener | XP_806409 XP_806409 |
353153 |
Trypanosoma grayi | Trypanosoma grayi | XP_009309127 XP_009309127 |
71804 |
Trypanosoma rangeli SC58 | Trypanosoma rangeli sc58 | ESL11841 ESL12025 ESL11841 ESL12025 |
429131 |
Trypanosoma vivax Y486 | Trypanosoma vivax y486 | CCC50411 CCC50409 CCC50411 CCC50409 |
1055687 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.