Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
None.
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-4.0101 | 6689 |
| Shrimp | Pen-m-4.0101 | 6687 |
| Crayfish | Pon-l-4.0101 | 6717 |
Species containing the peptide NTLIEGR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Acytostelium subglobosum LB1 | Acytostelium subglobosum lb1 | XP_012749920 XP_012749920 XP_012749920 |
1410327 |
| Bison bison bison | Bison | XP_010855598 XP_010855598 XP_010855598 |
43346 |
| Dictyostelium discoideum AX4 | Dictyostelium discoideum ax4 | XP_637315 XP_637315 XP_637315 |
352472 |
| Dictyostelium fasciculatum | Dictyostelium fasciculatum | XP_004350409 XP_004350409 XP_004350409 |
261658 |
| Dictyostelium lacteum | Dictyostelium lacteum | KYQ91601 KYQ91601 KYQ91601 |
361077 |
| Dictyostelium purpureum | Dictyostelium purpureum | XP_003291186 XP_003291186 XP_003291186 |
5786 |
| Diplodia seriata | Diplodia seriata | KKY13465 KKY13465 KKY13465 |
420778 |
| Drosophila yakuba | Drosophila yakuba | XP_002098850 XP_002098850 XP_002098850 |
7245 |
| Eriocheir sinensis | Chinese mitten crab | AJG01361 AJG01360 AJG01359 AJG01361 AJG01360 AJG01359 AJG01361 AJG01360 AJG01359 |
95602 |
| Fenneropenaeus orientalis | Fenneropenaeus orientalis | 1006232A 1006232A 1006232A |
70917 |
| Hyalella azteca | Hyalella azteca | XP_018019896 XP_018019895 XP_018019896 XP_018019895 XP_018019896 XP_018019895 |
294128 |
| Komagataella pastoris | Komagataella pastoris | ANZ77993 ANZ77993 ANZ77993 |
4922 |
| Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 ACM89179 |
6689 |
| Marsupenaeus japonicus | Marsupenaeus japonicus | BAL72726 BAL72726 BAL72726 |
27405 |
| Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
| Penaeus sp. | Penaeus sp. | P02636 P02636 P02636 |
6688 |
| Polysphondylium pallidum PN500 | Polysphondylium pallidum pn500 | EFA86812 EFA86812 EFA86812 |
670386 |
| Pontastacus leptodactylus | Narrow-clawed crayfish | P05946 P05946 P05946 |
6717 |
| Procambarus clarkii | Red swamp crayfish | ABB58783 AEG79569 AEG79568 AEG79567 ABB58783 AEG79569 AEG79568 AEG79567 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
| Scylla paramamosain | Green mud crab | AFJ80778 AFJ80778 AFJ80778 |
85552 |
| Xenopus laevis | African clawed frog | OCT64712 OCT64712 OCT64712 |
8355 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.